SFRS8 Antikörper

Produktnummer ABIN633458

Der Kaninchen Polyklonal Anti-SFRS8-Antikörper wurde für WB validiert. Er ist geeignet, SFRS8 in Proben von Human und Maus zu detektieren.

Kurzübersicht für SFRS8 Antikörper (ABIN633458)

Target: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFRS8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SFRS8 Antikörper

Aufreinigung: Affinity purified

Immunogen: SFRS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVFGYACKLFRDDERALAQEQGQHLIPWMGDHKILIDRYDGRGHLHDLSE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS8 Blocking Peptide, (ABIN5616105), is also available for use as a blocking control in assays to test for specificity of this SFRS8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFRS8

Target: SFRS8 (SFSWAP) (Splicing Factor, Suppressor of White-Apricot Homolog (SFSWAP))

Andere Bezeichnung: SFRS8

Hintergrund: This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Multiple alternatively spliced variants have been identified although their full-length natures have not been characterized to date.

Molekulargewicht: 105 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization