SFRS9 Antikörper (Middle Region)

Produktnummer ABIN633457

Produktdetails anti-SFRS9 Antikörper

Target: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFRS9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SFRS9 antibody was raised against the middle region of SFRS9

Aufreinigung: Affinity purified

Immunogen: SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS9 Blocking Peptide, catalog no. 33R-9457, is also available for use as a blocking control in assays to test for specificity of this SFRS9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFRS9

Target: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Andere Bezeichnung: SFRS9 (SFRS9 Produkte)

Synonyme: SFRS9 antikoerper, SRp30c antikoerper, 25kDa antikoerper, 2610029M16Rik antikoerper, Sfrs9 antikoerper, sfrs9 antikoerper, srp30c antikoerper, zgc:77449 antikoerper, serine and arginine rich splicing factor 9 antikoerper, serine/arginine-rich splicing factor 9 antikoerper, serine/arginine-rich splicing factor 9 L homeolog antikoerper, SRSF9 antikoerper, Srsf9 antikoerper, srsf9.L antikoerper, srsf9 antikoerper

Hintergrund: SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization