SFRS9 Antikörper (Middle Region)

Produktnummer ABIN633457

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SFRS9 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus, Ratte und C. elegans.

Kurzübersicht für SFRS9 Antikörper (Middle Region) (ABIN633457)

Target: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Reaktivität: Human, Maus, Ratte, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFRS9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SFRS9 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SFRS9 antibody was raised against the middle region of SFRS9

Aufreinigung: Affinity purified

Immunogen: SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS9 Blocking Peptide, (ABIN5616107), is also available for use as a blocking control in assays to test for specificity of this SFRS9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFRS9

Target: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Andere Bezeichnung: SFRS9

Hintergrund: SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization