Synaptojanin 1 Antikörper (N-Term)
-
- Target Alle Synaptojanin 1 (SYNJ1) Antikörper anzeigen
- Synaptojanin 1 (SYNJ1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Synaptojanin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Synaptojanin 1 antibody was raised against the N terminal of SYNJ1
- Aufreinigung
- Affinity purified
- Immunogen
- Synaptojanin 1 antibody was raised using the N terminal of SYNJ1 corresponding to a region with amino acids IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR
- Top Product
- Discover our top product SYNJ1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Synaptojanin 1 Blocking Peptide, catalog no. 33R-3930, is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNJ1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Synaptojanin 1 (SYNJ1)
- Andere Bezeichnung
- Synaptojanin 1 (SYNJ1 Produkte)
- Hintergrund
- Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.
- Molekulargewicht
- 143 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process, Synaptic Vesicle Exocytosis
-