CPSF2 Antikörper (N-Term)

Produktnummer ABIN633438

Produktdetails anti-CPSF2 Antikörper

Target: CPSF2 (Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPSF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CPSF2 antibody was raised against the N terminal of CPSF2

Aufreinigung: Affinity purified

Immunogen: CPSF2 antibody was raised using the N terminal of CPSF2 corresponding to a region with amino acids YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPSF2 Blocking Peptide, catalog no. 33R-10053, is also available for use as a blocking control in assays to test for specificity of this CPSF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPSF2

Target: CPSF2 (Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2))

Andere Bezeichnung: CPSF2 (CPSF2 Produkte)

Synonyme: CPSF100 antikoerper, 100kDa antikoerper, 2610024B04Rik antikoerper, AI662483 antikoerper, Cpsf antikoerper, MCPSF antikoerper, mKIAA1367 antikoerper, zgc:92484 antikoerper, cpsf2-A antikoerper, cleavage and polyadenylation specific factor 2 antikoerper, cleavage and polyadenylation specific factor 2 S homeolog antikoerper, cleavage and polyadenylation specificity factor subunit 2 antikoerper, CPSF2 antikoerper, Cpsf2 antikoerper, cpsf2 antikoerper, PAAG_07931 antikoerper, cpsf2.S antikoerper, LOC582050 antikoerper, LOC100157277 antikoerper, LOC100179344 antikoerper

Hintergrund: CPSF2 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. It belongs to the metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, CPSF2/YSH1 subfamily.

Molekulargewicht: 88 kDa (MW of target protein)