CELF1 Antikörper (N-Term)
-
- Target Alle CELF1 Antikörper anzeigen
- CELF1 (CUGBP, Elav-Like Family Member 1 (CELF1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CELF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CUGBP1 antibody was raised against the N terminal of CUGBP1
- Aufreinigung
- Affinity purified
- Immunogen
- CUGBP1 antibody was raised using the N terminal of CUGBP1 corresponding to a region with amino acids AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT
- Top Product
- Discover our top product CELF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CUGBP1 Blocking Peptide, catalog no. 33R-1032, is also available for use as a blocking control in assays to test for specificity of this CUGBP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CELF1 (CUGBP, Elav-Like Family Member 1 (CELF1))
- Andere Bezeichnung
- CUGBP1 (CELF1 Produkte)
- Synonyme
- CUGBP1 antikoerper, BRUNOL2 antikoerper, CUG-BP antikoerper, CUGBP antikoerper, EDEN-BP antikoerper, NAB50 antikoerper, NAPOR antikoerper, hNab50 antikoerper, 1600010O03Rik antikoerper, AA407467 antikoerper, Brunol2 antikoerper, CUG-BP1 antikoerper, Cugbp1 antikoerper, D2Wsu101e antikoerper, HNAB50 antikoerper, Bruno-like antikoerper, brul antikoerper, cb920 antikoerper, cugbp1 antikoerper, brunol2 antikoerper, cug-bp antikoerper, cug-bp1 antikoerper, cugbp antikoerper, cugbp1-a antikoerper, eden-bp antikoerper, edenbp antikoerper, nab50 antikoerper, CUGBP Elav-like family member 1 antikoerper, CUGBP, Elav-like family member 1 antikoerper, cugbp, Elav-like family member 1 antikoerper, CUGBP Elav-like family member 1 L homeolog antikoerper, CELF1 antikoerper, Celf1 antikoerper, celf1 antikoerper, celf1.L antikoerper
- Hintergrund
- Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-