CELF1 Antikörper (N-Term)

Produktnummer ABIN633435

Produktdetails anti-CELF1 Antikörper

Target: CELF1 (CUGBP, Elav-Like Family Member 1 (CELF1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CELF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CUGBP1 antibody was raised against the N terminal of CUGBP1

Aufreinigung: Affinity purified

Immunogen: CUGBP1 antibody was raised using the N terminal of CUGBP1 corresponding to a region with amino acids AALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CUGBP1 Blocking Peptide, catalog no. 33R-1032, is also available for use as a blocking control in assays to test for specificity of this CUGBP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CUGBP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CELF1

Target: CELF1 (CUGBP, Elav-Like Family Member 1 (CELF1))

Andere Bezeichnung: CUGBP1 (CELF1 Produkte)

Hintergrund: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization