RAD51AP1 Antikörper (Middle Region)
-
- Target Alle RAD51AP1 Antikörper anzeigen
- RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RAD51AP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RAD51 AP1 antibody was raised against the middle region of RAD51 P1
- Aufreinigung
- Affinity purified
- Immunogen
- RAD51 AP1 antibody was raised using the middle region of RAD51 P1 corresponding to a region with amino acids EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD
- Top Product
- Discover our top product RAD51AP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RAD51AP1 Blocking Peptide, catalog no. 33R-2308, is also available for use as a blocking control in assays to test for specificity of this RAD51AP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Konzentration
- Lot specific
- Buffer
- Supplied as cell culture supernatant.
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))
- Andere Bezeichnung
- RAD51AP1 (RAD51AP1 Produkte)
- Synonyme
- PIR51 antikoerper, 2510006L10Rik antikoerper, RAB22 antikoerper, RAD51 associated protein 1 antikoerper, Rad51ap1 antikoerper, RAD51AP1 antikoerper
- Hintergrund
- RAD51AP1 may participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51AP1 binds to single and double stranded DNA, and is capable of aggregating DNA. RAD51AP1 also binds RNA.
- Molekulargewicht
- 37 kDa (MW of target protein)
-