RAD51AP1 Antikörper (Middle Region)

Produktnummer ABIN633433

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RAD51AP1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für RAD51AP1 Antikörper (Middle Region) (ABIN633433)

Target: RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAD51AP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAD51AP1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RAD51 AP1 antibody was raised against the middle region of RAD51 P1

Aufreinigung: Affinity purified

Immunogen: RAD51 AP1 antibody was raised using the middle region of RAD51 P1 corresponding to a region with amino acids EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAD51AP1 Blocking Peptide, (ABIN937694), is also available for use as a blocking control in assays to test for specificity of this RAD51AP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Konzentration: Lot specific

Buffer: Supplied as cell culture supernatant.

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAD51AP1

Target: RAD51AP1 (RAD51-Interacting Protein (RAD51AP1))

Andere Bezeichnung: RAD51AP1

Hintergrund: RAD51AP1 may participate in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. RAD51AP1 binds to single and double stranded DNA, and is capable of aggregating DNA. RAD51AP1 also binds RNA.

Molekulargewicht: 37 kDa (MW of target protein)