RBM7 Antikörper (Middle Region)

Produktnummer ABIN633432

Produktdetails anti-RBM7 Antikörper

Target: RBM7 (RNA Binding Motif Protein 7 (RBM7))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBM7 antibody was raised against the middle region of RBM7

Aufreinigung: Affinity purified

Immunogen: RBM7 antibody was raised using the middle region of RBM7 corresponding to a region with amino acids SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM7 Blocking Peptide, catalog no. 33R-8434, is also available for use as a blocking control in assays to test for specificity of this RBM7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM7

Target: RBM7 (RNA Binding Motif Protein 7 (RBM7))

Andere Bezeichnung: RBM7 (RBM7 Produkte)

Synonyme: 1200007M24Rik antikoerper, 1500011D06Rik antikoerper, AU041934 antikoerper, AW554393 antikoerper, RNA binding motif protein 7 antikoerper, RBM7 antikoerper, Rbm7 antikoerper

Hintergrund: RBM7 contains 1 RRM (RNA recognition motif) domain. It is possible involved in germ cell RNA processing and meiosis.

Molekulargewicht: 30 kDa (MW of target protein)