GIPC1 Antikörper (N-Term)
-
- Target Alle GIPC1 Antikörper anzeigen
- GIPC1 (GIPC PDZ Domain Containing Family, Member 1 (GIPC1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GIPC1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GIPC1 antibody was raised against the N terminal of GIPC1
- Aufreinigung
- Affinity purified
- Immunogen
- GIPC1 antibody was raised using the N terminal of GIPC1 corresponding to a region with amino acids SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA
- Top Product
- Discover our top product GIPC1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GIPC1 Blocking Peptide, catalog no. 33R-8461, is also available for use as a blocking control in assays to test for specificity of this GIPC1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIPC1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GIPC1 (GIPC PDZ Domain Containing Family, Member 1 (GIPC1))
- Andere Bezeichnung
- GIPC1 (GIPC1 Produkte)
- Synonyme
- C19orf3 antikoerper, GIPC antikoerper, GLUT1CBP antikoerper, Hs.6454 antikoerper, IIP-1 antikoerper, NIP antikoerper, RGS19IP1 antikoerper, SEMCAP antikoerper, SYNECTIIN antikoerper, SYNECTIN antikoerper, TIP-2 antikoerper, XGIPC antikoerper, kermit antikoerper, rgs19ip1 antikoerper, gipc3 antikoerper, iip-1 antikoerper, Kermit antikoerper, semcap antikoerper, glut1cbp antikoerper, synectiin antikoerper, GIPC1 antikoerper, Glut1CIP antikoerper, Rgs19ip1 antikoerper, Semcap1 antikoerper, TaxIP2 antikoerper, Gipc antikoerper, Rgs19 antikoerper, GIPC PDZ domain containing family member 1 antikoerper, GIPC PDZ domain containing family member 1 L homeolog antikoerper, GIPC PDZ domain containing family, member 1 antikoerper, RGS-GAIP interacting protein GIPC antikoerper, PDZ domain-containing protein GIPC3 antikoerper, putative rgs-gaip interacting protein gipc antikoerper, GIPC1 antikoerper, gipc1.L antikoerper, gipc1 antikoerper, Gipc1 antikoerper, LOC692815 antikoerper, LOC5576629 antikoerper, Smp_170870 antikoerper
- Hintergrund
- GIPC1 belongs to the GIPC family. It may be involved in G protein-linked signaling.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-