GIPC1 Antikörper (N-Term)

Produktnummer ABIN633430

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch GIPC1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte, Zebrafisch (Danio rerio) und Hund.

Kurzübersicht für GIPC1 Antikörper (N-Term) (ABIN633430)

Target: GIPC1 (GIPC PDZ Domain Containing Family, Member 1 (GIPC1))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GIPC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GIPC1 Antikörper

Bindungsspezifität: N-Term

Spezifität: GIPC1 antibody was raised against the N terminal of GIPC1

Aufreinigung: Affinity purified

Immunogen: GIPC1 antibody was raised using the N terminal of GIPC1 corresponding to a region with amino acids SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GIPC1 Blocking Peptide, (ABIN5613765), is also available for use as a blocking control in assays to test for specificity of this GIPC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIPC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GIPC1

Target: GIPC1 (GIPC PDZ Domain Containing Family, Member 1 (GIPC1))

Andere Bezeichnung: GIPC1

Hintergrund: GIPC1 belongs to the GIPC family. It may be involved in G protein-linked signaling.

Molekulargewicht: 37 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport