KLHDC8A Antikörper (Middle Region)

Produktnummer ABIN633427

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch KLHDC8A in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für KLHDC8A Antikörper (Middle Region) (ABIN633427)

Target: KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KLHDC8A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KLHDC8A Antikörper

Bindungsspezifität: Middle Region

Spezifität: KLHDC8 A antibody was raised against the middle region of KLHDC8

Aufreinigung: Affinity purified

Immunogen: KLHDC8 A antibody was raised using the middle region of KLHDC8 corresponding to a region with amino acids NQPTVLETAEAFHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLHDC8A Blocking Peptide, (ABIN5614373), is also available for use as a blocking control in assays to test for specificity of this KLHDC8A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KLHDC8A

Target: KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))

Andere Bezeichnung: KLHDC8A

Hintergrund: The function of KLHDC8A protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 39 kDa (MW of target protein)