RBPMS2 Antikörper (Middle Region)

Produktnummer ABIN633407

Der Kaninchen Polyklonal Anti-RBPMS2-Antikörper wurde für WB validiert. Er ist geeignet, RBPMS2 in Proben von Human zu detektieren.

Kurzübersicht für RBPMS2 Antikörper (Middle Region) (ABIN633407)

Target: RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBPMS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBPMS2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RBPMS2 antibody was raised against the middle region of RBPMS2

Aufreinigung: Affinity purified

Immunogen: RBPMS2 antibody was raised using the middle region of RBPMS2 corresponding to a region with amino acids MGAALIPASPEAWAPYPLYTTELTPAISHAAFTYPTATAAAAALHAQVRW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBPMS2 Blocking Peptide, (ABIN5615811), is also available for use as a blocking control in assays to test for specificity of this RBPMS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBPMS2

Target: RBPMS2 (RNA Binding Protein with Multiple Splicing 2 (RBPMS2))

Andere Bezeichnung: RBPMS2

Hintergrund: The function of RBPMS2 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 22 kDa (MW of target protein)