NOVA1 Antikörper (C-Term)
-
- Target Alle NOVA1 Antikörper anzeigen
- NOVA1 (Neuro-Oncological Ventral Antigen 1 (NOVA1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NOVA1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NOVA1 antibody was raised against the C terminal of NOVA1
- Aufreinigung
- Affinity purified
- Immunogen
- NOVA1 antibody was raised using the C terminal of NOVA1 corresponding to a region with amino acids SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG
- Top Product
- Discover our top product NOVA1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NOVA1 Blocking Peptide, catalog no. 33R-8555, is also available for use as a blocking control in assays to test for specificity of this NOVA1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOVA1 (Neuro-Oncological Ventral Antigen 1 (NOVA1))
- Andere Bezeichnung
- NOVA1 (NOVA1 Produkte)
- Synonyme
- Nova-1 antikoerper, NOVA1 antikoerper, si:ch211-222c22.9 antikoerper, 9430099M15Rik antikoerper, G630039L02 antikoerper, NOVA alternative splicing regulator 1 antikoerper, neuro-oncological ventral antigen 1 L homeolog antikoerper, neuro-oncological ventral antigen 1 antikoerper, RNA-binding protein Nova-1 antikoerper, lipid A export ATP-binding/permease protein antikoerper, NOVA1 antikoerper, Nova1 antikoerper, nova1.L antikoerper, nova1 antikoerper, LOC790874 antikoerper, novA1 antikoerper
- Hintergrund
- NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognised and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.
- Molekulargewicht
- 52 kDa (MW of target protein)
-