NOVA1 Antikörper (C-Term)

Produktnummer ABIN633405

Dieses Anti-NOVA1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NOVA1 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für NOVA1 Antikörper (C-Term) (ABIN633405)

Target: NOVA1 (Neuro-Oncological Ventral Antigen 1 (NOVA1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOVA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NOVA1 Antikörper

Bindungsspezifität: C-Term

Spezifität: NOVA1 antibody was raised against the C terminal of NOVA1

Aufreinigung: Affinity purified

Immunogen: NOVA1 antibody was raised using the C terminal of NOVA1 corresponding to a region with amino acids SKKGEFVPGTRNRKVTITGTPAATQAAQYLITQRITYEQGVRAANPQKVG

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOVA1 Blocking Peptide, catalog no. 33R-8555, is also available for use as a blocking control in assays to test for specificity of this NOVA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOVA1

Target: NOVA1 (Neuro-Oncological Ventral Antigen 1 (NOVA1))

Andere Bezeichnung: NOVA1

Hintergrund: NOVA1 is a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognised and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer.

Molekulargewicht: 52 kDa (MW of target protein)