OLA1 Antikörper

Produktnummer ABIN633398

Der Kaninchen Polyklonal anti-OLA1 Antikörper wird verwendet zum Nachweis von OLA1 in Proben von Human, Maus, Ratte, Zebrafisch (Danio rerio) und Drosophila melanogaster. Er wurde validiert für WB.

Kurzübersicht für OLA1 Antikörper (ABIN633398)

Target: OLA1 (Obg-Like ATPase 1 (OLA1))

Reaktivität: Human, Maus, Ratte, Zebrafisch (Danio rerio), Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OLA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-OLA1 Antikörper

Aufreinigung: Affinity purified

Immunogen: GTPBP9 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GTPBP9 Blocking Peptide, (ABIN5613906), is also available for use as a blocking control in assays to test for specificity of this GTPBP9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OLA1

Target: OLA1 (Obg-Like ATPase 1 (OLA1))

Andere Bezeichnung: GTPBP9

Hintergrund: GTPBP9 belongs to the GTP1/OBG family and the function remains unknown.

Molekulargewicht: 44 kDa (MW of target protein)