RBM4 Antikörper (Middle Region)

Produktnummer ABIN633396

Produktdetails anti-RBM4 Antikörper

Target: RBM4 (RNA Binding Motif Protein 4 (RBM4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBM4 antibody was raised against the middle region of RBM4

Aufreinigung: Affinity purified

Immunogen: RBM4 antibody was raised using the middle region of RBM4 corresponding to a region with amino acids TAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTPY

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM4 Blocking Peptide, catalog no. 33R-8981, is also available for use as a blocking control in assays to test for specificity of this RBM4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM4

Target: RBM4 (RNA Binding Motif Protein 4 (RBM4))

Andere Bezeichnung: RBM4 (RBM4 Produkte)

Hintergrund: RBM4 contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing. RBM4 is down-regulated in fetal Down syndrome (DS) brain.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Regulation of Muscle Cell Differentiation, Photoperiodism