AUH Antikörper (C-Term)

Produktnummer ABIN633391

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch AUH in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Ratte, Maus und Hund.

Kurzübersicht für AUH Antikörper (C-Term) (ABIN633391)

Target: AUH (AU RNA Binding Protein/enoyl-CoA Hydratase (AUH))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AUH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-AUH Antikörper

Bindungsspezifität: C-Term

Spezifität: AUH antibody was raised against the C terminal of AUH

Aufreinigung: Affinity purified

Immunogen: AUH antibody was raised using the C terminal of AUH corresponding to a region with amino acids IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AUH Blocking Peptide, (ABIN939360), is also available for use as a blocking control in assays to test for specificity of this AUH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AUH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AUH

Target: AUH (AU RNA Binding Protein/enoyl-CoA Hydratase (AUH))

Andere Bezeichnung: AUH

Hintergrund: AU-specific RNA-binding enoyl-CoA hydratase (AUH) protein binds to the AU-rich element (ARE), a common element found in the 3' UTR of rapidly decaying mRNA such as c-fos, c-myc and granulocyte/ macrophage colony stimulating factor. ARE elements are involved in directing RNA to rapid degradation and deadenylation. AUH is also homologous to enol-CoA hydratase, an enzyme involved in fatty acid degradation, and has been shown to have intrinsic hydratase enzymatic activity. AUH is thus a bifunctional chimera between RNA binding and metabolic enzyme activity.

Molekulargewicht: 37 kDa (MW of target protein)