ANKRD42 Antikörper (N-Term)

Produktnummer ABIN633385

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ANKRD42 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ANKRD42 Antikörper (N-Term) (ABIN633385)

Target: ANKRD42 (Ankyrin Repeat Domain 42 (ANKRD42))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANKRD42 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ANKRD42 Antikörper

Bindungsspezifität: N-Term

Spezifität: ANKRD42 antibody was raised against the N terminal of ANKRD42

Aufreinigung: Affinity purified

Immunogen: ANKRD42 antibody was raised using the N terminal of ANKRD42 corresponding to a region with amino acids PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANKRD42 Blocking Peptide, (ABIN5612067), is also available for use as a blocking control in assays to test for specificity of this ANKRD42 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD42 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANKRD42

Target: ANKRD42 (Ankyrin Repeat Domain 42 (ANKRD42))

Andere Bezeichnung: ANKRD42

Hintergrund: The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 43 kDa (MW of target protein)