ENOX1 Antikörper (Middle Region)

Produktnummer ABIN633381

Produktdetails anti-ENOX1 Antikörper

Target: ENOX1 (Ecto-NOX Disulfide-Thiol Exchanger 1 (ENOX1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ENOX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ENOX1 antibody was raised against the middle region of ENOX1

Aufreinigung: Affinity purified

Immunogen: ENOX1 antibody was raised using the middle region of ENOX1 corresponding to a region with amino acids QQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQAKEEQSHTQALLKVLQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ENOX1 Blocking Peptide, catalog no. 33R-7696, is also available for use as a blocking control in assays to test for specificity of this ENOX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENOX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ENOX1

Target: ENOX1 (Ecto-NOX Disulfide-Thiol Exchanger 1 (ENOX1))

Andere Bezeichnung: ENOX1 (ENOX1 Produkte)

Synonyme: CNOX antikoerper, PIG38 antikoerper, bA64J21.1 antikoerper, cCNOX antikoerper, B230207J08 antikoerper, D230005D02Rik antikoerper, RGD1306118 antikoerper, ecto-NOX disulfide-thiol exchanger 1 S homeolog antikoerper, ecto-NOX disulfide-thiol exchanger 1 antikoerper, enox1.S antikoerper, ENOX1 antikoerper, Enox1 antikoerper

Hintergrund: Electron transport pathways are generally associated with mitochondrial membranes, but non-mitochondrial pathways are also biologically significant. Plasma membrane electron transport pathways are involved in functions as diverse as cellular defense, intracellular redox homeostasis, and control of cell growth and survival. Members of the ecto-NOX family, such as CNOX, or ENOX1, are involved in plasma membrane transport pathways. These enzymes exhibit both a hydroquinone (NADH) oxidase activity and a protein disulfide-thiol interchange activity in series, with each activity cycling every 22 to 26 minutes.

Molekulargewicht: 73 kDa (MW of target protein)