RG9MTD1 Antikörper
Kurzübersicht für RG9MTD1 Antikörper (ABIN633378)
Target
Alle RG9MTD1 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Aufreinigung
- Affinity purified
-
Immunogen
- RG9 MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
RG9MTD1 Blocking Peptide, (ABIN5615841), is also available for use as a blocking control in assays to test for specificity of this RG9MTD1 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD1 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
- Avoid repeated freeze/thaw cycles.
-
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- RG9MTD1 (RNA (Guanine-9-) Methyltransferase Domain Containing 1 (RG9MTD1))
-
Andere Bezeichnung
- RG9MTD1
-
Hintergrund
- RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.
-
Molekulargewicht
- 47 kDa (MW of target protein)
Target
-