MRPL24 Antikörper (N-Term)

Produktnummer ABIN633373

Produktdetails anti-MRPL24 Antikörper

Target: MRPL24 (Mitochondrial Ribosomal Protein L24 (MRPL24))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPL24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MRPL24 antibody was raised against the N terminal of MRPL24

Aufreinigung: Affinity purified

Immunogen: MRPL24 antibody was raised using the N terminal of MRPL24 corresponding to a region with amino acids RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPL24 Blocking Peptide, catalog no. 33R-8157, is also available for use as a blocking control in assays to test for specificity of this MRPL24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPL24

Target: MRPL24 (Mitochondrial Ribosomal Protein L24 (MRPL24))

Andere Bezeichnung: MRPL24 (MRPL24 Produkte)

Synonyme: L24mt antikoerper, MRP-L18 antikoerper, MRP-L24 antikoerper, CG8849 antikoerper, Dmel\\CG8849 antikoerper, L24 antikoerper, RpL24 antikoerper, 2010005E08Rik antikoerper, 2810470K06Rik antikoerper, 6720473G22Rik antikoerper, AA407670 antikoerper, rpl24 antikoerper, rpl24-A antikoerper, GB10626 antikoerper, zgc:92702 antikoerper, l24mt antikoerper, mrp-l18 antikoerper, mrp-l24 antikoerper, mitochondrial ribosomal protein L24 antikoerper, mitochondrial ribosomal protein L24 L homeolog antikoerper, probable 39S ribosomal protein L24, mitochondrial antikoerper, mitochondrial 54S ribosomal protein YmL24/YmL14 antikoerper, mitochondrial ribosomal protein subunit L28 (predicted) antikoerper, Putative mitochondrial ribosomal protein L24 antikoerper, MRPL24 antikoerper, mRpL24 antikoerper, Mrpl24 antikoerper, mrpl24 antikoerper, mrpl24.L antikoerper, LOC408675 antikoerper, CAALFM_C203950WA antikoerper

Hintergrund: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. MRPL24 is a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24).

Molekulargewicht: 25 kDa (MW of target protein)