MRPL24 Antikörper (N-Term)

Produktnummer ABIN633373

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MRPL24 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MRPL24 Antikörper (N-Term) (ABIN633373)

Target: MRPL24 (Mitochondrial Ribosomal Protein L24 (MRPL24))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPL24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MRPL24 Antikörper

Bindungsspezifität: N-Term

Spezifität: MRPL24 antibody was raised against the N terminal of MRPL24

Aufreinigung: Affinity purified

Immunogen: MRPL24 antibody was raised using the N terminal of MRPL24 corresponding to a region with amino acids RRRPVVVEPISDEDWYLFCGDTVEILEGKDAGKQGKVVQVIRQRNWVVVG

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPL24 Blocking Peptide, (ABIN5614841), is also available for use as a blocking control in assays to test for specificity of this MRPL24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPL24

Target: MRPL24 (Mitochondrial Ribosomal Protein L24 (MRPL24))

Andere Bezeichnung: MRPL24

Hintergrund: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. MRPL24 is a 39S subunit protein which is more than twice the size of its E.coli counterpart (EcoL24).

Molekulargewicht: 25 kDa (MW of target protein)