DHX35 Antikörper

Produktnummer ABIN633370

Produktdetails anti-DHX35 Antikörper

Target: DHX35 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DHX35 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHX35 Blocking Peptide, catalog no. 33R-5605, is also available for use as a blocking control in assays to test for specificity of this DHX35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHX35

Target: DHX35 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35))

Andere Bezeichnung: DHX35 (DHX35 Produkte)

Synonyme: MGC146350 antikoerper, C20orf15 antikoerper, DDX35 antikoerper, KAIA0875 antikoerper, 1200009D07Rik antikoerper, Ddx35 antikoerper, probable ATP-dependent RNA helicase DHX35 antikoerper, DEAH-box helicase 35 antikoerper, DEAH (Asp-Glu-Ala-His) box polypeptide 35 antikoerper, LOC413147 antikoerper, DHX35 antikoerper, dhx35 antikoerper, LOC100633419 antikoerper, Dhx35 antikoerper

Hintergrund: DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.

Molekulargewicht: 79 kDa (MW of target protein)