DHX35 Antikörper

Produktnummer ABIN633370

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DHX35 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für DHX35 Antikörper (ABIN633370)

Target: DHX35 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DHX35 Antikörper

Aufreinigung: Affinity purified

Immunogen: DHX35 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHX35 Blocking Peptide, (ABIN5613197), is also available for use as a blocking control in assays to test for specificity of this DHX35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHX35

Target: DHX35 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 35 (DHX35))

Andere Bezeichnung: DHX35

Hintergrund: DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of DHX35 which is a member of this family, has not been determined.

Molekulargewicht: 79 kDa (MW of target protein)