DHX32 Antikörper
-
- Target Alle DHX32 Antikörper anzeigen
- DHX32 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHX32 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DHX32 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR
- Top Product
- Discover our top product DHX32 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHX32 Blocking Peptide, catalog no. 33R-2347, is also available for use as a blocking control in assays to test for specificity of this DHX32 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX32 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX32 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32))
- Andere Bezeichnung
- DHX32 (DHX32 Produkte)
- Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.
- Molekulargewicht
- 84 kDa (MW of target protein)
-