DHX32 Antikörper

Produktnummer ABIN633369

Dieses Anti-DHX32-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DHX32 in WB. Geeignet für Human.

Kurzübersicht für DHX32 Antikörper (ABIN633369)

Target: DHX32 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX32 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DHX32 Antikörper

Aufreinigung: Affinity purified

Immunogen: DHX32 antibody was raised using a synthetic peptide corresponding to a region with amino acids EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHX32 Blocking Peptide, (ABIN937733), is also available for use as a blocking control in assays to test for specificity of this DHX32 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX32 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHX32

Target: DHX32 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 32 (DHX32))

Andere Bezeichnung: DHX32

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.

Molekulargewicht: 84 kDa (MW of target protein)