RBM22 Antikörper (C-Term)

Produktnummer ABIN633355

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RBM22 in WB und IHC. Er zeigt eine Reaktivität gegenüber Human, Maus, Ratte und Hund.

Kurzübersicht für RBM22 Antikörper (C-Term) (ABIN633355)

Target: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM22 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-RBM22 Antikörper

Bindungsspezifität: C-Term

Spezifität: RBM22 antibody was raised against the C terminal of RBM22

Aufreinigung: Affinity purified

Immunogen: RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM22 Blocking Peptide, (ABIN940116), is also available for use as a blocking control in assays to test for specificity of this RBM22 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM22 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM22

Target: RBM22 (RNA Binding Motif Protein 22 (RBM22))

Andere Bezeichnung: RBM22

Hintergrund: RBM22 may be involved in pre-mRNA splicing.

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus