PCBP3 Antikörper
-
- Target Alle PCBP3 Antikörper anzeigen
- PCBP3 (Poly(rC) Binding Protein 3 (PCBP3))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCBP3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
- Top Product
- Discover our top product PCBP3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCBP3 Blocking Peptide, catalog no. 33R-7759, is also available for use as a blocking control in assays to test for specificity of this PCBP3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCBP3 (Poly(rC) Binding Protein 3 (PCBP3))
- Andere Bezeichnung
- PCBP3 (PCBP3 Produkte)
- Synonyme
- AlphaCP-3 antikoerper, ALPHA-CP3 antikoerper, alpha-CP3 antikoerper, zgc:109966 antikoerper, poly(rC) binding protein 3 antikoerper, Pcbp3 antikoerper, PCBP3 antikoerper, pcbp3 antikoerper
- Hintergrund
- This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions.
- Molekulargewicht
- 36 kDa (MW of target protein)
-