PCBP3 Antikörper

Produktnummer ABIN633353

Der Kaninchen Polyklonal Anti-PCBP3-Antikörper wurde für WB validiert. Er ist geeignet, PCBP3 in Proben von Human und Maus zu detektieren.

Kurzübersicht für PCBP3 Antikörper (ABIN633353)

Target: PCBP3 (Poly(rC) Binding Protein 3 (PCBP3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCBP3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PCBP3 Antikörper

Aufreinigung: Affinity purified

Immunogen: PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCBP3 Blocking Peptide, (ABIN5615235), is also available for use as a blocking control in assays to test for specificity of this PCBP3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCBP3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCBP3

Target: PCBP3 (Poly(rC) Binding Protein 3 (PCBP3))

Andere Bezeichnung: PCBP3

Hintergrund: This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions.

Molekulargewicht: 36 kDa (MW of target protein)