CELF4 Antikörper

Produktnummer ABIN633349

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch CELF4 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für CELF4 Antikörper (ABIN633349)

Target: CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CELF4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CELF4 Antikörper

Aufreinigung: Affinity purified

Immunogen: BRUNOL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BRUNOL4 Blocking Peptide, (ABIN5612366), is also available for use as a blocking control in assays to test for specificity of this BRUNOL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRUNOL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CELF4

Target: CELF4 (CUGBP, Elav-Like Family Member 4 (CELF4))

Andere Bezeichnung: BRUNOL4

Hintergrund: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Synaptic Membrane