GRSF1 Antikörper (Middle Region)

Produktnummer ABIN633346

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch GRSF1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für GRSF1 Antikörper (Middle Region) (ABIN633346)

Target: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRSF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GRSF1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: GRSF1 antibody was raised against the middle region of GRSF1

Aufreinigung: Affinity purified

Immunogen: GRSF1 antibody was raised using the middle region of GRSF1 corresponding to a region with amino acids IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRSF1 Blocking Peptide, (ABIN939525), is also available for use as a blocking control in assays to test for specificity of this GRSF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRSF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRSF1

Target: GRSF1 (G-Rich RNA Sequence Binding Factor 1 (GRSF1))

Andere Bezeichnung: GRSF1

Hintergrund: GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.

Molekulargewicht: 53 kDa (MW of target protein)