HNRNPA1L2 Antikörper (N-Term)

Produktnummer ABIN633345

Dieses Anti-HNRNPA1L2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von HNRNPA1L2 in WB und IHC. Geeignet für Human, Hund, Maus und Ratte.

Kurzübersicht für HNRNPA1L2 Antikörper (N-Term) (ABIN633345)

Target: HNRNPA1L2 (Heterogeneous Nuclear Ribonucleoprotein A1-Like 2 (HNRNPA1L2))

Reaktivität: Human, Hund, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPA1L2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-HNRNPA1L2 Antikörper

Bindungsspezifität: N-Term

Spezifität: RP11-78 J21.1 antibody was raised against the N terminal of RP11-78 21.1

Aufreinigung: Affinity purified

Immunogen: RP11-78 J21.1 antibody was raised using the N terminal of RP11-78 21.1 corresponding to a region with amino acids MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RP.1 Blocking Peptide, (ABIN5615924), is also available for use as a blocking control in assays to test for specificity of this RP.1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-70 21.1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPA1L2

Target: HNRNPA1L2 (Heterogeneous Nuclear Ribonucleoprotein A1-Like 2 (HNRNPA1L2))

Hintergrund: The function of RP11-78J21.1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 35 kDa (MW of target protein)