MECOM Antikörper (N-Term)
-
- Target Alle MECOM Antikörper anzeigen
- MECOM (MDS1 and EVI1 Complex Locus (MECOM))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MECOM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EVI1 antibody was raised against the N terminal of EVI1
- Aufreinigung
- Affinity purified
- Immunogen
- EVI1 antibody was raised using the N terminal of EVI1 corresponding to a region with amino acids VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP
- Top Product
- Discover our top product MECOM Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EVI1 Blocking Peptide, catalog no. 33R-9619, is also available for use as a blocking control in assays to test for specificity of this EVI1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVI1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MECOM (MDS1 and EVI1 Complex Locus (MECOM))
- Andere Bezeichnung
- EVI1 (MECOM Produkte)
- Synonyme
- AML1-EVI-1 antikoerper, EVI1 antikoerper, MDS1 antikoerper, MDS1-EVI1 antikoerper, PRDM3 antikoerper, D630039M04Rik antikoerper, Evi-1 antikoerper, Evi1 antikoerper, Jbo antikoerper, Mds antikoerper, Mds1 antikoerper, Mds1-Evi1 antikoerper, Prdm3 antikoerper, Znfpr1b1 antikoerper, evi1 antikoerper, im:7140716 antikoerper, prdm3 antikoerper, evi-1 antikoerper, mecom antikoerper, mecom-a antikoerper, mecom-b antikoerper, xEvi-1 antikoerper, evi1-B antikoerper, MDS1 and EVI1 complex locus antikoerper, MDS1 and EVI1 complex locus L homeolog antikoerper, MDS1 and EVI1 complex locus S homeolog antikoerper, MECOM antikoerper, Mecom antikoerper, mecom antikoerper, mecom.L antikoerper, mecom.S antikoerper
- Hintergrund
- EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.
- Molekulargewicht
- 118 kDa (MW of target protein)
-