MECOM Antikörper (N-Term)

Produktnummer ABIN633344

Der Kaninchen Polyklonal anti-MECOM Antikörper wird verwendet zum Nachweis von MECOM in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für MECOM Antikörper (N-Term) (ABIN633344)

Target: MECOM (MDS1 and EVI1 Complex Locus (MECOM))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MECOM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MECOM Antikörper

Bindungsspezifität: N-Term

Spezifität: EVI1 antibody was raised against the N terminal of EVI1

Aufreinigung: Affinity purified

Immunogen: EVI1 antibody was raised using the N terminal of EVI1 corresponding to a region with amino acids VKGLSSTEQTNKSQSPLMTHPQILPATQDILKALSKHPSVGDNKPVELQP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EVI1 Blocking Peptide, (ABIN5613418), is also available for use as a blocking control in assays to test for specificity of this EVI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MECOM

Target: MECOM (MDS1 and EVI1 Complex Locus (MECOM))

Andere Bezeichnung: EVI1

Hintergrund: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Molekulargewicht: 118 kDa (MW of target protein)