EIF3B Antikörper (C-Term)

Produktnummer ABIN633340

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch EIF3B in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für EIF3B Antikörper (C-Term) (ABIN633340)

Target: EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF3B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EIF3B Antikörper

Bindungsspezifität: C-Term

Spezifität: EIF3 S9 antibody was raised against the C terminal of EIF3 9

Aufreinigung: Affinity purified

Immunogen: EIF3 S9 antibody was raised using the C terminal of EIF3 9 corresponding to a region with amino acids YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF3S9 Blocking Peptide, (ABIN936200), is also available for use as a blocking control in assays to test for specificity of this EIF3S9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF3B

Target: EIF3B (Eukaryotic Translation Initiation Factor 3, Subunit B (EIF3B))

Andere Bezeichnung: EIF3S9

Hintergrund: EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.

Molekulargewicht: 90 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization