A1CF Antikörper (N-Term)

Produktnummer ABIN633338

Der Kaninchen Polyklonal Anti-A1CF-Antikörper wurde für WB validiert. Er ist geeignet, A1CF in Proben von Human zu detektieren.

Kurzübersicht für A1CF Antikörper (N-Term) (ABIN633338)

Target: A1CF (APOBEC1 Complementation Factor (A1CF))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser A1CF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-A1CF Antikörper

Bindungsspezifität: N-Term

Spezifität: A1 CF antibody was raised against the N terminal of A1 F

Aufreinigung: Affinity purified

Immunogen: A1 CF antibody was raised using the N terminal of A1 F corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

A1CF Blocking Peptide, (ABIN937672), is also available for use as a blocking control in assays to test for specificity of this A1CF antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of A0 F antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu A1CF

Target: A1CF (APOBEC1 Complementation Factor (A1CF))

Andere Bezeichnung: A1CF

Hintergrund: Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. A1CF has three non-identical RNA recognition motifs and belongs to the hnRNP R family of RNA-binding proteins. It has been proposed that this complementation factor functions as an RNA-binding subunit and docks APOBEC-1 to deaminate the upstream cytidine. Studies suggest that the protein may also be involved in other RNA editing or RNA processing events.

Molekulargewicht: 65 kDa (MW of target protein)