MECOM Antikörper (Middle Region)

Produktnummer ABIN633330

Produktdetails anti-MECOM Antikörper

Target: MECOM (MDS1 and EVI1 Complex Locus (MECOM))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MECOM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EVI1 antibody was raised against the middle region of EVI1

Aufreinigung: Affinity purified

Immunogen: EVI1 antibody was raised using the middle region of EVI1 corresponding to a region with amino acids KHPSVGDNKPVELQPERSSEERPFEKISDQSESSDLDDVSTPSGSDLETT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EVI1 Blocking Peptide, catalog no. 33R-4417, is also available for use as a blocking control in assays to test for specificity of this EVI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EVI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MECOM

Target: MECOM (MDS1 and EVI1 Complex Locus (MECOM))

Andere Bezeichnung: EVI1 (MECOM Produkte)

Synonyme: AML1-EVI-1 antikoerper, EVI1 antikoerper, MDS1 antikoerper, MDS1-EVI1 antikoerper, PRDM3 antikoerper, D630039M04Rik antikoerper, Evi-1 antikoerper, Evi1 antikoerper, Jbo antikoerper, Mds antikoerper, Mds1 antikoerper, Mds1-Evi1 antikoerper, Prdm3 antikoerper, Znfpr1b1 antikoerper, evi1 antikoerper, im:7140716 antikoerper, prdm3 antikoerper, evi-1 antikoerper, mecom antikoerper, mecom-a antikoerper, mecom-b antikoerper, xEvi-1 antikoerper, evi1-B antikoerper, MDS1 and EVI1 complex locus antikoerper, MDS1 and EVI1 complex locus L homeolog antikoerper, MDS1 and EVI1 complex locus S homeolog antikoerper, MECOM antikoerper, Mecom antikoerper, mecom antikoerper, mecom.L antikoerper, mecom.S antikoerper

Hintergrund: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.

Molekulargewicht: 118 kDa (MW of target protein)