BOLL Antikörper
-
- Target Alle BOLL Antikörper anzeigen
- BOLL (Bol, Boule-Like (BOLL))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BOLL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- BOLL antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ
- Top Product
- Discover our top product BOLL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BOLL Blocking Peptide, catalog no. 33R-3288, is also available for use as a blocking control in assays to test for specificity of this BOLL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BOLL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BOLL (Bol, Boule-Like (BOLL))
- Andere Bezeichnung
- BOLL (BOLL Produkte)
- Synonyme
- BOULE antikoerper, 4930554P13Rik antikoerper, 4930597B14Rik antikoerper, RGD1559527 antikoerper, boule homolog, RNA binding protein antikoerper, bol, boule-like (Drosophila) antikoerper, BOLL antikoerper, Boll antikoerper
- Hintergrund
- This gene belongs to the DAZ gene family required for germ cell development. BOLL is an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition.
- Molekulargewicht
- 31 kDa (MW of target protein)
-