MIF4GD Antikörper (N-Term)

Produktnummer ABIN633321

Dieses Anti-MIF4GD-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von MIF4GD in WB. Geeignet für Human.

Kurzübersicht für MIF4GD Antikörper (N-Term) (ABIN633321)

Target: MIF4GD (MIF4G Domain Containing (MIF4GD))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MIF4GD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MIF4GD Antikörper

Bindungsspezifität: N-Term

Spezifität: MIF4 GD antibody was raised against the N terminal of MIF4 D

Aufreinigung: Affinity purified

Immunogen: MIF4 GD antibody was raised using the N terminal of MIF4 D corresponding to a region with amino acids MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MIF4GD Blocking Peptide, catalog no. 33R-6024, is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIF0 D antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MIF4GD

Target: MIF4GD (MIF4G Domain Containing (MIF4GD))

Andere Bezeichnung: MIF4GD

Hintergrund: MIF4GD is a protein which contains an MIF4G domain.

Molekulargewicht: 29 kDa (MW of target protein)