EXOSC7 Antikörper (N-Term)
-
- Target Alle EXOSC7 Antikörper anzeigen
- EXOSC7 (Exosome Component 7 (EXOSC7))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EXOSC7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- EXOSC7 antibody was raised against the N terminal of EXOSC7
- Aufreinigung
- Affinity purified
- Immunogen
- EXOSC7 antibody was raised using the N terminal of EXOSC7 corresponding to a region with amino acids EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC
- Top Product
- Discover our top product EXOSC7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EXOSC7 Blocking Peptide, catalog no. 33R-2780, is also available for use as a blocking control in assays to test for specificity of this EXOSC7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EXOSC7 (Exosome Component 7 (EXOSC7))
- Andere Bezeichnung
- EXOSC7 (EXOSC7 Produkte)
- Synonyme
- EXOSC7 antikoerper, zgc:110717 antikoerper, EAP1 antikoerper, RRP42 antikoerper, Rrp42p antikoerper, hRrp42p antikoerper, p8 antikoerper, 2610002K22Rik antikoerper, AV212732 antikoerper, mKIAA0116 antikoerper, exosome component 7 antikoerper, exosome component 7 S homeolog antikoerper, exosc7 antikoerper, EXOSC7 antikoerper, exosc7.S antikoerper, Exosc7 antikoerper
- Hintergrund
- EXOSC7 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. The protein is required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA.
- Molekulargewicht
- 32 kDa (MW of target protein)
-