XRN1 Antikörper (Middle Region)

Produktnummer ABIN633318

Dieses Anti-XRN1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von XRN1 in WB. Geeignet für Human und Ratte.

Kurzübersicht für XRN1 Antikörper (Middle Region) (ABIN633318)

Target: XRN1 (5'-3' Exoribonuclease 1 (XRN1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser XRN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-XRN1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: XRN1 antibody was raised against the middle region of XRN1

Aufreinigung: Affinity purified

Immunogen: XRN1 antibody was raised using the middle region of XRN1 corresponding to a region with amino acids LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

XRN1 Blocking Peptide, (ABIN5617047), is also available for use as a blocking control in assays to test for specificity of this XRN1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XRN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu XRN1

Target: XRN1 (5'-3' Exoribonuclease 1 (XRN1))

Andere Bezeichnung: XRN1

Hintergrund: SEP1 (XRN1) localizes to cytoplasmic foci containing a complex of mRNA-degrading enzymes. In addition to mRNA metabolism, yeast Sep1 has been implicated in a variety of nuclear and cytoplasmic functions, including homologous recombination, meiosis, telomere maintenance, and microtubule assembly.

Molekulargewicht: 194 kDa (MW of target protein)