MOV10L1 Antikörper

Produktnummer ABIN633316

Produktdetails anti-MOV10L1 Antikörper

Target: MOV10L1 (Mov10l1, Moloney Leukemia Virus 10-Like 1 (MOV10L1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MOV10L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: MOV10 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MOV10L1 Blocking Peptide, catalog no. 33R-5253, is also available for use as a blocking control in assays to test for specificity of this MOV10L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOV10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MOV10L1

Target: MOV10L1 (Mov10l1, Moloney Leukemia Virus 10-Like 1 (MOV10L1))

Andere Bezeichnung: MOV10L1 (MOV10L1 Produkte)

Synonyme: CHAMP antikoerper, Csm antikoerper, DJ402G11.8 antikoerper, Mov10 RISC complex RNA helicase like 1 antikoerper, Moloney leukemia virus 10-like 1 antikoerper, MOV10L1 antikoerper, mov10l1 antikoerper, Mov10l1 antikoerper

Hintergrund: This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 135 kDa (MW of target protein)