MOV10L1 Antikörper

Produktnummer ABIN633316

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MOV10L1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MOV10L1 Antikörper (ABIN633316)

Target: MOV10L1 (Mov10l1, Moloney Leukemia Virus 10-Like 1 (MOV10L1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MOV10L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MOV10L1 Antikörper

Aufreinigung: Affinity purified

Immunogen: MOV10 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MOV10L1 Blocking Peptide, (ABIN5614818), is also available for use as a blocking control in assays to test for specificity of this MOV10L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOV10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MOV10L1

Target: MOV10L1 (Mov10l1, Moloney Leukemia Virus 10-Like 1 (MOV10L1))

Andere Bezeichnung: MOV10L1

Hintergrund: This gene is similar to a mouse gene that encodes a putative RNA helicase and shows testis-specific expression. Multiple transcript variants encoding different isoforms have been found for this gene.

Molekulargewicht: 135 kDa (MW of target protein)