AGFG1 Antikörper (Middle Region)

Produktnummer ABIN633314

Der Kaninchen Polyklonal anti-AGFG1 Antikörper wird verwendet zum Nachweis von AGFG1 in Proben von Human und Maus. Er wurde validiert für WB.

Kurzübersicht für AGFG1 Antikörper (Middle Region) (ABIN633314)

Target: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGFG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-AGFG1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HRB antibody was raised against the middle region of HRB

Aufreinigung: Affinity purified

Immunogen: HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HRB Blocking Peptide, (ABIN5614067), is also available for use as a blocking control in assays to test for specificity of this HRB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGFG1

Target: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Andere Bezeichnung: HRB

Hintergrund: HRB is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. HRB binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs.

Molekulargewicht: 58 kDa (MW of target protein)