AGFG1 Antikörper (Middle Region)

Produktnummer ABIN633314

Produktdetails anti-AGFG1 Antikörper

Target: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AGFG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HRB antibody was raised against the middle region of HRB

Aufreinigung: Affinity purified

Immunogen: HRB antibody was raised using the middle region of HRB corresponding to a region with amino acids SQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HRB Blocking Peptide, catalog no. 33R-8725, is also available for use as a blocking control in assays to test for specificity of this HRB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AGFG1

Target: AGFG1 (HRB) (HIV-1 Rev Binding Protein (HRB))

Andere Bezeichnung: HRB (HRB Produkte)

Synonyme: HRB antikoerper, RAB antikoerper, RIP antikoerper, AU045498 antikoerper, C130049H11Rik antikoerper, C85612 antikoerper, D730048C23Rik antikoerper, Hrb antikoerper, Rip antikoerper, hrb antikoerper, agfg1 antikoerper, wu:fb14f05 antikoerper, wu:fi19d11 antikoerper, MGC83726 antikoerper, MGC97591 antikoerper, ArfGAP with FG repeats 1 antikoerper, ArfGAP with FG repeats 1a antikoerper, ArfGAP with FG repeats 1 S homeolog antikoerper, KRR1 small subunit processome component homolog antikoerper, AGFG1 antikoerper, Agfg1 antikoerper, agfg1a antikoerper, agfg1.S antikoerper, agfg1 antikoerper, LOC5565923 antikoerper

Hintergrund: HRB is related to nucleoporins, a class of proteins that mediate nucleocytoplasmic transport. HRB binds the activation domain of the human immunodeficiency virus Rev protein when Rev is assembled onto its RNA target, and is required for the nuclear export of Rev-directed RNAs.

Molekulargewicht: 58 kDa (MW of target protein)