-
- Target Alle DHX58 Antikörper anzeigen
- DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHX58 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM
- Top Product
- Discover our top product DHX58 Primärantikörper
-
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (AA 479-678) antibody
DHX58 Reaktivität: Human WB, ELISA, IHC, FACS, ICC Wirt: Maus Monoclonal 3E11F1 unconjugated
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (AA 479-678) antibodyDHX58 Reaktivität: Human WB, ELISA, IHC, FACS, ICC Wirt: Maus Monoclonal 6A6A3 unconjugated
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (AA 389-678) antibodyDHX58 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (C-Term) antibodyVerified DHX58 Reaktivität: Human WB, ELISA, IHC Wirt: Ziege Polyclonal unconjugated
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (AA 41-69), (N-Term) antibodyDHX58 Reaktivität: Human WB, IHC (p) Wirt: Kaninchen Polyclonal RB26842 unconjugated
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) antibodyDHX58 Reaktivität: Human, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (AA 1-678) antibodyDHX58 Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (Internal Region) antibodyDHX58 Reaktivität: Human WB, IHC, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (AA 389-678) antibodyDHX58 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58) (AA 1-678) antibodyDHX58 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHX58 Blocking Peptide, catalog no. 33R-1634, is also available for use as a blocking control in assays to test for specificity of this DHX58 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX58 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))
- Andere Bezeichnung
- DHX58 (DHX58 Produkte)
- Synonyme
- MGC82787 antikoerper, DHX58 antikoerper, lgp2 antikoerper, D11LGP2 antikoerper, D11lgp2e antikoerper, LGP2 antikoerper, RLR-3 antikoerper, B430001I08Rik antikoerper, D11Lgp2e antikoerper, LPG2 antikoerper, Lgp2 antikoerper, RGD1310093 antikoerper, DEXH-box helicase 58 L homeolog antikoerper, DExH-box helicase 58 antikoerper, probable ATP-dependent RNA helicase DHX58 antikoerper, DEXH (Asp-Glu-X-His) box polypeptide 58 antikoerper, DEXH-box helicase 58 antikoerper, dhx58.L antikoerper, DHX58 antikoerper, dhx58 antikoerper, LOC100566102 antikoerper, Dhx58 antikoerper
- Hintergrund
- DHX58 is the negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling.
- Molekulargewicht
- 76 kDa (MW of target protein)
-
Sie sind hier:
