DHX58 Antikörper
-
- Target Alle DHX58 Antikörper anzeigen
- DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DHX58 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM
- Top Product
- Discover our top product DHX58 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DHX58 Blocking Peptide, catalog no. 33R-1634, is also available for use as a blocking control in assays to test for specificity of this DHX58 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX58 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))
- Andere Bezeichnung
- DHX58 (DHX58 Produkte)
- Hintergrund
- DHX58 is the negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling.
- Molekulargewicht
- 76 kDa (MW of target protein)
-