DHX58 Antikörper

Produktnummer ABIN633307

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DHX58 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für DHX58 Antikörper (ABIN633307)

Target: DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX58 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DHX58 Antikörper

Aufreinigung: Affinity purified

Immunogen: DHX58 antibody was raised using a synthetic peptide corresponding to a region with amino acids AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHX58 Blocking Peptide, (ABIN937020), is also available for use as a blocking control in assays to test for specificity of this DHX58 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX58 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHX58

Target: DHX58 (DEXH (Asp-Glu-X-His) Box Polypeptide 58 (DHX58))

Andere Bezeichnung: DHX58

Hintergrund: DHX58 is the negative regulator of host innate immune defense against viruses. The repressor domain of DHX58 interacts with DDX58 and negatively regulates DDX58-mediated signaling.

Molekulargewicht: 76 kDa (MW of target protein)