DGCR8 Antikörper (N-Term)

Produktnummer ABIN633303

Dieses Anti-DGCR8-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DGCR8 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für DGCR8 Antikörper (N-Term) (ABIN633303)

Target: DGCR8 (DiGeorge Syndrome Critical Region Gene 8 (DGCR8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DGCR8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DGCR8 Antikörper

Bindungsspezifität: N-Term

Spezifität: DGCR8 antibody was raised against the N terminal of DGCR8

Aufreinigung: Affinity purified

Immunogen: DGCR8 antibody was raised using the N terminal of DGCR8 corresponding to a region with amino acids DKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DGCR8 Blocking Peptide, (ABIN937407), is also available for use as a blocking control in assays to test for specificity of this DGCR8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DGCR8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DGCR8

Target: DGCR8 (DiGeorge Syndrome Critical Region Gene 8 (DGCR8))

Andere Bezeichnung: DGCR8

Hintergrund: DGCR8 contains 2 DRBM (double-stranded RNA-binding) domains and 1 WW domain. It may play a part in the etiology of the velocardiofacial/DiGeorge syndrome (VCFS/DGS), a developmental disorder characterized by structural and functional palate anomalies, conotruncal cardiac malformations, immunodeficiency, hypocalcemia, and typical facial anomalies.

Molekulargewicht: 85 kDa (MW of target protein)

Pathways: Regulatorische RNA Pathways