DND1 Antikörper

Produktnummer ABIN633302

Der Kaninchen Polyklonal anti-DND1 Antikörper wird verwendet zum Nachweis von DND1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für DND1 Antikörper (ABIN633302)

Target: DND1 (Dead End Homolog 1 (DND1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DND1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DND1 Antikörper

Aufreinigung: Affinity purified

Immunogen: DND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DND1 Blocking Peptide, (ABIN939226), is also available for use as a blocking control in assays to test for specificity of this DND1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DND1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DND1

Target: DND1 (Dead End Homolog 1 (DND1))

Andere Bezeichnung: DND1

Hintergrund: DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration.

Molekulargewicht: 39 kDa (MW of target protein)