EIF4H Antikörper (C-Term)

Produktnummer ABIN633301

Produktdetails anti-EIF4H Antikörper

Target: EIF4H (Eukaryotic Translation Initiation Factor 4H (EIF4H))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EIF4H Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EIF4 H antibody was raised against the C terminal of EIF4

Aufreinigung: Affinity purified

Immunogen: EIF4 H antibody was raised using the C terminal of EIF4 corresponding to a region with amino acids TEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKEQE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EIF4H Blocking Peptide, catalog no. 33R-9032, is also available for use as a blocking control in assays to test for specificity of this EIF4H antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EIF4H

Target: EIF4H (Eukaryotic Translation Initiation Factor 4H (EIF4H))

Andere Bezeichnung: EIF4H (EIF4H Produkte)

Synonyme: wscr1 antikoerper, wbscr1 antikoerper, WBSCR1 antikoerper, Wbscr1 antikoerper, WSCR1 antikoerper, eIF-4H antikoerper, AU018978 antikoerper, D5Ertd355e antikoerper, E430026L18Rik antikoerper, Ef4h antikoerper, Wscr1 antikoerper, mKIAA0038 antikoerper, zgc:77282 antikoerper, eukaryotic translation initiation factor 4H antikoerper, eukaryotic translation initiation factor 4H L homeolog antikoerper, eukaryotic translation initiation factor 4h antikoerper, transaltion initiation factor antikoerper, Eukaryotic translation initiation factor 4H antikoerper, eif4h antikoerper, eif4h.L antikoerper, EIF4H antikoerper, Eif4h antikoerper, LOC733087 antikoerper, SJAG_03433 antikoerper, MGYG_07815 antikoerper, Tsp_06589 antikoerper, if4h antikoerper

Hintergrund: EIF4H is one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom