RBM45 Antikörper (Middle Region)

Produktnummer ABIN633300

Dieses Anti-RBM45-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RBM45 in WB. Geeignet für Human und Ratte.

Kurzübersicht für RBM45 Antikörper (Middle Region) (ABIN633300)

Target: RBM45 (RNA Binding Motif Protein 45 (RBM45))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBM45 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBM45 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RBM45 antibody was raised against the middle region of RBM45

Aufreinigung: Affinity purified

Immunogen: RBM45 antibody was raised using the middle region of RBM45 corresponding to a region with amino acids MRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRGQEAISKRLSVVSRVPFT

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBM45 Blocking Peptide, (ABIN5615795), is also available for use as a blocking control in assays to test for specificity of this RBM45 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM45 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBM45

Target: RBM45 (RNA Binding Motif Protein 45 (RBM45))

Andere Bezeichnung: RBM45

Hintergrund: RBM45 is a RNA-binding protein with binding specificity for poly(C). It May play an important role in neural development. RBM45 contains 3 RRM (RNA recognition motif) domains.

Molekulargewicht: 53 kDa (MW of target protein)